PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10031348m
Common NameCICLE_v10031052mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 490aa    MW: 54698.4 Da    PI: 6.5462
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10031348mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like772.5e-24105158155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Ciclev10031348m 105 KARVVWSIDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 158
                      68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.9E-10157No hitNo description
PROSITE profilePS5011014.541139IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521722.28E-6252IPR011006CheY-like superfamily
Gene3DG3DSA:1.10.10.602.2E-27103163IPR009057Homeodomain-like
SuperFamilySSF466896.09E-17103162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-21105158IPR006447Myb domain, plants
PfamPF002495.0E-7107157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MSVDGETSRV MKGVQHGACD YLLKPIRMKE LRNIWQHVFR KRIHEVRDIE NIEGFESIHM  60
TRSGSDQSVD GPLLTGEDLT SVRKRKDAEN RHDDRDCGDA SSTKKARVVW SIDLHQKFVK  120
AVNQIGFDKV GPKKILDLMN VPWLTRENVA SHLQKYRLYL TRLQKDELKT SVGGIKQKDS  180
PSKDSAASFG IQNSITVHHH NDVSNGGYRF SGSNSVVQNV DAKSLEGDVK GIDTIPVTGH  240
KRVLTVDIPN SHKARCSQIG FSGSFVPGHS DVNFTSLDSA IPTQPWSEVS ETQFQHEHKP  300
LRLENDFTQL PLPGPRHHIQ VDCIQSGPSA ISKPSVVDKD NLKPFDCTYK SNHPNAIPIG  360
SAVDTFPVQT TSPIVNHQPF EPIARTTSSM KSQGLNLSCI PDLEAAQRNI NWGVGSSLTS  420
LDEDLQLCWL QGDCFAMNLG LQDINFSEYN DPALNSEVPF HLYDTMRFDY EHYYDPTECP  480
IIDQGLFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-18101163163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438146.10.0hypothetical protein CICLE_v10031052mg
RefseqXP_006438147.10.0hypothetical protein CICLE_v10031052mg
TrEMBLV4TDL10.0V4TDL1_9R
TrEMBLV4TNH30.0V4TNH3_9R
STRINGVIT_01s0010g02230.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-89response regulator 11